- Recombinant Ricinus communis CASP-like protein RCOM_1174750 (RCOM_1174750)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1172409
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 17,610 Da
- E Coli or Yeast
- 1-163
- CASP-like protein RCOM_1174750 (RCOM_1174750)
Sequence
MAKAKRVFTLLLRLIAFGTALVAAIVMATSHESGSFFTVSYEAKYSDTPAFKYFVIVNAIVTVYSFLALFLPSESLLWRLVIVTDVVFTMLVTSSISAAVAVAQVGKKGNSHAGWLPICGQVPKFCDQVTGALAAAFISLITYAILLLYSIHTVLNPLLLQKT